PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g04530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 349aa    MW: 40006.7 Da    PI: 8.9676
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g04530.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-13176220347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
   Vang01g04530.1 176 PWTEEEHRRFLMGLLKYGKGDWRNISRNFVVTKTPTQVASHAQKY 220
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.62472126IPR017884SANT domain
SMARTSM007175.6E-973125IPR001005SANT/Myb domain
SuperFamilySSF466895.66E-1175130IPR009057Homeodomain-like
PfamPF002491.3E-576121IPR001005SANT/Myb domain
CDDcd001676.34E-776122No hitNo description
PROSITE profilePS5129419.353169225IPR017930Myb domain
SuperFamilySSF466894.11E-16171225IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17172224IPR006447Myb domain, plants
SMARTSM007175.6E-11173223IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-10173219IPR009057Homeodomain-like
CDDcd001671.05E-8176220No hitNo description
PfamPF002497.1E-11176220IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
LVGVRGSTLF LVSSTRQQHL CCFSFRIRQT LTPKFWYSMI FPRFCTNLKG MELETLYPPC  60
FMPDSNWFVE ESQSTEWSRE DNKKFESALA IYDKDTPDRW FKVAAMIPGK TVLDVIKQYR  120
ELEEDVIEIE AGRVPIPGYL ASSFTFELVH NHNYDGCRRR PAAVRGSDQE RKKGVPWTEE  180
EHRRFLMGLL KYGKGDWRNI SRNFVVTKTP TQVASHAQKY YIRQKVSGGK DKRRPSIHDI  240
TTVNLTETAA SDKIKSPFMI TPQQKLNSMS KVQLDWTSHC NDGSLMVFNP NRDNLFVSSS  300
SDIMALKMQG QDLYDCALHE AYAKVKVPGF GMAPRDFNNE AIFGIHAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-16771391173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505357.10.0PREDICTED: transcription factor DIVARICATA-like isoform X1
SwissprotQ8S9H72e-89DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0S3RKJ90.0A0A0S3RKJ9_PHAAN; Uncharacterized protein
STRINGGLYMA02G42140.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.18e-93MYB family protein